Zazwyczaj kuracja trwa od kilku tygodni do kilku miesicy, w zalenoci od poziomu stresu oksydacyjnego, stylu ycia i diety
Nakamura K, Maitani Y, Lowman AM, Takayama K, Peppas NA, Nagai T
& Stevens, M
Anti-inflammatory and antiarthritic properties of Marrubium vulgare aqueous extract in an animal model
The difference between the two treatments is how they achieve this

In various embodiments, the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of (a) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 DRHSDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO: 1], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (b) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 DRHSDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:2], wherein Xaa1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (c) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 DRHSDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:3], wherein Xaa1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (d) 8 or more contiguous amino acid residues from the sequence SKKKKDRHSDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:4], (e) 8 or more contiguous amino acid residues from the sequence DRHSDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:5], (f) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 SLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:6], wherein Xaa1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (g) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 SLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:7], wherein Xaa1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (h) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 SLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:8], wherein Xaa1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (i) 8 or more contiguous amino acid residues from the sequence SKKKKSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:9], (j) 8 or more contiguous amino acid residues from the sequence SLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:10], (k) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 SDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:11], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (l) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 SDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:12], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (m) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 SDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:13], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (n) 8 or more contiguous amino acid residues from the sequence SKKKKSDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:14], (o) 8 or more contiguous amino acid residues from the sequence SDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:15], (p) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 DRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:16], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (q) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 DRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:17], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (r) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 DRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:18], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (s) 8 or more contiguous amino acid residues from the sequence SKKKKDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:19], (t) 8 or more contiguous amino acid residues from the sequence DRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:20], (u) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 LLWTLVVLLICSSCSSCPLSKILLARLFLYALALLL [SEQ ID NO:21], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (v) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 LLWTLVVLLICSSCSSCPLSKILLARLFLYALALLL [SEQ ID NO:22], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (w) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 LLWTLVVLLICSSCSSCPLSKILLARLFLYALALLL [SEQ ID NO:23], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (x) 8 or more contiguous amino acid residues from the sequence SKKKKLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLL [SEQ ID NO:24], (y) 8 or more contiguous amino acid residues from the sequence LLWTLVVLLICSSCSSCPLSKILLARLFLYALALLL [SEQ ID NO:25], (z) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 LMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:26], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (aa) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 LMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:27], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (bb) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 LMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:28], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (cc) 8 or more contiguous amino acid residues from the sequence SKKKKLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:29], (dd) 8 or more contiguous amino acid residues from the sequence LMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:30], (ee) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 LMLLWTLVVLLICSSCSSCPLSKILL [SEQ ID NO:31], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (ff) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 LMLLWTLVVLLICSSCSSCPLSKILL [SEQ ID NO:32], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (gg) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 LMLLWTLVVLLICSSCSSCPLSKILL [SEQ ID NO:33], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (hh) 8 or more contiguous amino acid residues from the sequence SKKKKLMLLWTLVVLLICSSCSSCPLSKILL [SEQ ID NO:34], (ii) 8 or more contiguous amino acid residues from the sequence LMLLWTLVVLLICSSCSSCPLSKILL [SEQ ID NO:35], (jj) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 LLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:36], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (kk) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 LLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:37], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (ll) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 LLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:38], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (mm) 8 or more contiguous amino acid residues from the sequence SKKKKLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:39], (nn) 8 or more contiguous amino acid residues from the sequence LLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:40], (oo) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 LNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIA GGSI [SEQ ID NO:41], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (pp) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 LNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGS I [SEQ ID NO:42], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (qq) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 LNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSI [SEQ ID NO:43], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (rr) 8 or more contiguous amino acid residues from the sequence SKKKKLNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSI [SEQ ID NO:44], (ss) 8 or more contiguous amino acid residues from the sequence LNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSI [SEQ ID NO:45], (tt) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 FLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASA [SEQ ID NO:46], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (uu) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 FLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASA [SEQ ID NO:47], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (vv) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 FLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASA [SEQ ID NO:48], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (ww) 8 or more contiguous amino acid residues from the sequence SKKKKFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASA [SEQ ID NO:49], (xx) 8 or more contiguous amino acid residues from the sequence FLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASA [SEQ ID NO:50], (yy) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 LQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLL [SEQ ID NO:51], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (zz) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 LQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLL [SEQ ID NO:52], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (aaa) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 LQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLL [SEQ ID NO:53], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (bbb) 8 or more contiguous amino acid residues from the sequence SKKKKLQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLL [SEQ ID NO:54], (ccc) 8 or more contiguous amino acid residues from the sequence LQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLL [SEQ ID NO:55], (ddd) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 SGNRTYGPVFM(C)(S)LGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLI FLIGFA [SEQ ID NO:56], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (eee) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 SGNRTYGPVFM(C)(S)LGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIG FA [SEQ ID NO:57], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (fff) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 SGNRTYGPVFM(C)(S)LGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIGFA [SEQ ID NO:58], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (ggg) 8 or more contiguous amino acid residues from the sequence SKKKKSGNRTYGPVFM(C)(S)LGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIGFA [SEQ ID NO:59], (hhh) 8 or more contiguous amino acid residues from the sequence SGNRTYGPVFM(C)(S)LGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIGFA [SEQ ID NO:60], (iii) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 SNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPP [SEQ ID NO:61], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (jjj) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 SNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPP [SEQ ID NO:62], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (kkk) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 SNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPP [SEQ ID NO:63], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (lll) 8 or more contiguous amino acid residues from the sequence SKKKKSNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPP [SEQ ID NO:64], (mmm) 8 or more contiguous amino acid residues from the sequence SNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPP [SEQ ID NO:65], (nnn) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 GNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAA S [SEQ ID NO:66], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (ooo) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 GNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAAS [SEQ ID NO:67], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (ppp) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 GNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAAS [SEQ ID NO:68], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (qqq) 8 or more contiguous amino acid residues from the sequence SKKKKGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAAS [SEQ ID NO:69], (rrr) 8 or more contiguous amino acid residues from the sequence GNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAAS [SEQ ID NO:70], (sss) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 AAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLT [SEQ ID NO:71], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (ttt) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 AAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLT [SEQ ID NO:72], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (uuu) 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 AAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLT [SEQ ID NO:73], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, and Xaa 2 is absent or is from one to four hydrophilic amino acids, (vvv) 8 or more contiguous amino acid residues from the sequence SKKKKAAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLT [SEQ ID NO:74], (www) 8 or more contiguous amino acid residues from the sequence AAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLT [SEQ ID NO:75], (xxx) the sequence of any one of SEQ ID NOs: 1 to 75, (yyy) 8 or more contiguous amino acid residues from the sequence of any one of (zzz) the sequence of any one of SEQ ID NOs: 76-101, (aaaa) or any combination of two or more of (a) to (zzz) above
